Active Recombinant Mouse Ccl24 Protein (93 aa)
Cat.No. : | Ccl24-046C |
Product Overview : | Recombinant Mouse Ccl24 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 93 |
Description : | Eotaxin, also named MPIF-2 and Ckβ6, is a novel CC chemokine recently identified. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Additionally, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. Mouse Eotaxin-2 cDNA encodes a 119 amino acid (aa) residue precursor protein that shares approximately 58% aa sequence identity with human Eotaxin-2. Functionally, Eotaxin-2 is most closely related to Eotaxin/CCL11 and Eotaxin-3/CCL26. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract murine lymphocytes using a concentration range of 10.0 -100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 10.3 kDa, a single, non-glycosylated polypeptide chain containing 93 amino acids. |
AA Sequence : | VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV |
Endotoxin : | Less than 1 EU/μg of rMuEotaxin-2/CCL24 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl24 chemokine (C-C motif) ligand 24 [ Mus musculus ] |
Official Symbol | Ccl24 |
Synonyms | CCL24; chemokine (C-C motif) ligand 24; C-C motif chemokine 24; eotaxin-2; CC chemokine CCL24; small inducible cytokine A24; small-inducible cytokine A24; eosinophil chemotactic protein 2; CKb-6; MPIF-2; Scya24; |
Gene ID | 56221 |
mRNA Refseq | NM_019577 |
Protein Refseq | NP_062523 |
UniProt ID | Q9JKC0 |
◆ Recombinant Proteins | ||
Ccl24-818R | Recombinant Rat Ccl24 protein, His-tagged | +Inquiry |
CCL24-151H | Active Recombinant Human CCL24 Protein, His-tagged | +Inquiry |
CCL24-357H | Recombinant Human Chemokine (C-C motif) Ligand 24 | +Inquiry |
CCL24-036H | Active Recombinant Human CCL24 Protein, hFc-tagged | +Inquiry |
CCL24-51H | Recombinant Human CCL24 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL24-437HCL | Recombinant Human CCL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl24 Products
Required fields are marked with *
My Review for All Ccl24 Products
Required fields are marked with *
0
Inquiry Basket