| Species : | Mouse | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | Non | 
                                
                                    | Protein Length : | 93 | 
                                
                                    | Description : | CCL24, also named MPIF-2, Eotaxin-2 and Ckβ6, is a novel CC chemokine recently identified. It is a secreted protein, encoded by CCL24 gene, and produced by activated monocytes and T lymphocytes. CCL24 signals through the CCR3 receptor and has functions of chemotactic activity for resting T-lymphocytes and eosinophils, but none for monocytes and activated lymphocytes. The plasma levels of CCL24 and the aspirin-exacerbated respiratory disease (such as asthma) morbidity rate have positive correlation. | 
                                
                                    | Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. | 
                                
                                    | Bio-activity  : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine lymphocytes is in a concentration of 10-100 ng/ml. | 
                                
                                    | Molecular Mass : | Approximately 10.3 kDa, a single, non-glycosylated polypeptide chain containing 93 amino acids. | 
                                
                                    | AA Sequence : | VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV | 
                                
                                    | Endotoxin : | Less than 1 EU/μg of rMuEotaxin-2/CCL24 as determined by LAL method. | 
                                
                                    | Purity : | >97% by SDS-PAGE and HPLC analysis. | 
                                
                                    | Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. | 
                                
                                    | Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |