Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
74 |
Description : |
MCP-2 and MCP-3 are two recently identified monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood monocytes using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : |
8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : |
GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP |
Endotoxin : |
Less than 1 EU/μg of rMuMCP-2/CCL8 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |