Active Recombinant Mouse Ccl8 Protein (74 aa)
Cat.No. : | Ccl8-021C |
Product Overview : | Recombinant Mouse Ccl8 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 74 |
Description : | MCP-2 and MCP-3 are two recently identified monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood monocytes using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : | GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP |
Endotoxin : | Less than 1 EU/μg of rMuMCP-2/CCL8 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl8 chemokine (C-C motif) ligand 8 [ Mus musculus ] |
Official Symbol | Ccl8 |
Synonyms | CCL8; chemokine (C-C motif) ligand 8; C-C motif chemokine 8; small inducible cytokine A8; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; monocyte chemoattractant protein-2; HC14; Mcp2; MCP-2; Scya8; AB023418; 1810063B20Rik; |
Gene ID | 20307 |
mRNA Refseq | NM_021443 |
Protein Refseq | NP_067418 |
UniProt ID | Q9Z121 |
◆ Recombinant Proteins | ||
CCL8-032H | Recombinant Human CCL8 Protein, DDK-tagged | +Inquiry |
CCL8-692C | Recombinant Cattle CCL8 protein, His & GST-tagged | +Inquiry |
CCL8-695P | Recombinant Pig CCL8 protein, His & GST-tagged | +Inquiry |
Ccl8-10854m | Recombinant mouse Ccl8, GST-tagged | +Inquiry |
CCL8-1266H | Recombinant Human CCL8 Protein (Gln24-Pro99), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl8 Products
Required fields are marked with *
My Review for All Ccl8 Products
Required fields are marked with *
0
Inquiry Basket