Recombinant Human CCL8 protein
Cat.No. : | CCL8-284H |
Product Overview : | Recombinant Human CCL8 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 76 |
Description : | Human CCL8, also known as monocyte chemotactic protein 2 (MCP-2), is belonging to the CC chemokine family. It is encoded by the gene CCL8. MCP-2 has two homogeneous MCP-1 (CCL2) and MCP-3 (CCL7). These three MCPs were found by IL-1-beta triggered human MG-63 osteosarcoma cells. CCL8 shares 62 % amino acid sequence identity with MCP-1, and shares 58 % amino acid sequence identity with MCP-2. CCL8 has chemotactic function for monocytes, eosinophils and neutrophils. In addition, it can also chemoattract activated NK cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids. |
AA Sequence : | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
Endotoxin : | Less than 1 EU/μg of rHuMCP-2/CCL8 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL8 |
Official Symbol | CCL8 |
Synonyms | CCL8; chemokine (C-C motif) ligand 8; SCYA8, small inducible cytokine subfamily A (Cys Cys), member 8 (monocyte chemotactic protein 2); C-C motif chemokine 8; HC14; MCP 2; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); MCP2; MCP-2; SCYA8; SCYA10; |
Gene ID | 6355 |
mRNA Refseq | NM_005623 |
Protein Refseq | NP_005614 |
MIM | 602283 |
UniProt ID | P80075 |
◆ Recombinant Proteins | ||
CCL8-336C | Active Recombinant Human CCL8 Protein (76 aa) | +Inquiry |
Ccl8-10854m | Recombinant mouse Ccl8, GST-tagged | +Inquiry |
CCL8-2734D | Recombinant Dog CCL8 Protein, His-tagged | +Inquiry |
CCL8-151H | Recombinant Human CCL8 Protein, His-tagged | +Inquiry |
Ccl8-2042M | Active Recombinant Mouse Ccl8 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL8 Products
Required fields are marked with *
My Review for All CCL8 Products
Required fields are marked with *
0
Inquiry Basket