Recombinant Human CCL8 protein, GST-tagged
| Cat.No. : | CCL8-2656H |
| Product Overview : | Recombinant Human CCL8 protein(P80075)(24-99aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 24-99aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.9 kDa |
| AA Sequence : | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CCL8 chemokine (C-C motif) ligand 8 [ Homo sapiens ] |
| Official Symbol | CCL8 |
| Synonyms | CCL8; chemokine (C-C motif) ligand 8; SCYA8, small inducible cytokine subfamily A (Cys Cys), member 8 (monocyte chemotactic protein 2); C-C motif chemokine 8; HC14; MCP 2; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); MCP2; MCP-2; SCYA8; SCYA10; |
| Gene ID | 6355 |
| mRNA Refseq | NM_005623 |
| Protein Refseq | NP_005614 |
| MIM | 602283 |
| UniProt ID | P80075 |
| ◆ Recombinant Proteins | ||
| CCL8-29C | Recombinant Canine CCL8 protein | +Inquiry |
| CCL8-3706H | Recombinant Human CCL8 protein, rFc-tagged | +Inquiry |
| CCL8-695P | Recombinant Pig CCL8 protein, His & GST-tagged | +Inquiry |
| CCL8-313H | Recombinant Human CCL8 Protein, His-tagged | +Inquiry |
| Ccl8-202M | Recombinant Mouse Ccl8 protein(Gly24-Pro94), His&NusA-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL8 Products
Required fields are marked with *
My Review for All CCL8 Products
Required fields are marked with *



