Recombinant Human CCL8 protein, GST-tagged

• Cat.No.: CCL8-2656H
• Product Overview: Recombinant Human CCL8 protein(P80075)(24-99aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 24-99aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.9 kDa
• AA Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CCL8 chemokine (C-C motif) ligand 8 [ Homo sapiens ]
• Official Symbol: CCL8
• Synonyms: CCL8; chemokine (C-C motif) ligand 8; SCYA8, small inducible cytokine subfamily A (Cys Cys), member 8 (monocyte chemotactic protein 2); C-C motif chemokine 8; HC14; MCP 2; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); MCP2; MCP-2; SCYA8; SCYA10
• Gene ID: 6355
• mRNA Refseq: NM_005623
• Protein Refseq: NP_005614
• MIM: 602283
• UniProt ID: P80075