Active Recombinant Mouse Dhh Protein (176 aa)
Cat.No. : | Dhh-431D |
Product Overview : | Recombinant mouse Desert Hedgehog (DHH) produced in E. coli is a single non-glycosylated polypeptide chain containing 176 amino acids. A fully biologically active molecule, rmDHH has a molecular mass of 20.1kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 176 |
Description : | Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis. It is predicted to be made as a precursor that is auto-catalytically cleaved; the N-terminal portion is soluble and contains the signaling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. DHH may be involved in both male gonadal differentiation and perineurial development. DHH binds both Patched and Patched 2 as well as Hedgehog interacting protein (Hip). It induces steroidogenicfactor 1(SF1), which is instrumental in promoting Leydig cell differentiation. It also promotes the deposition of basal lamina surrounding seminiferous tubules. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 20 μg/mL, measured by its ability to induce alkaline phosphatase production by CCL-226 cells. |
Molecular Mass : | 20.1 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | IIGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Mouse Desert Hedgehog (DHH) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse Desert Hedgehog (DHH) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Dhh desert hedgehog [ Mus musculus ] |
Official Symbol | Dhh |
Synonyms | DHH; desert hedgehog; desert hedgehog protein; HHG-3; C78960; MGC73610; |
Gene ID | 13363 |
mRNA Refseq | NM_007857 |
Protein Refseq | NP_031883 |
UniProt ID | Q61488 |
◆ Recombinant Proteins | ||
Dhh-431D | Active Recombinant Mouse Dhh Protein (176 aa) | +Inquiry |
DHH-267H | Recombinant Human desert hedgehog, His-tagged | +Inquiry |
DHH-967H | Active Recombinant Human DHH | +Inquiry |
DHH-2531HF | Recombinant Full Length Human DHH Protein, GST-tagged | +Inquiry |
DHH-2589H | Recombinant Human DHH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHH-469HCL | Recombinant Human DHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Dhh Products
Required fields are marked with *
My Review for All Dhh Products
Required fields are marked with *
0
Inquiry Basket