| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    E.coli | 
                                
                                
                                    | Protein Length : | 
                                    177 | 
                                
                                
                                    | Description : | 
                                    Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis. It is predicted to be made as a precursor that is auto-catalytically cleaved; the N-terminal portion is soluble and contains the signaling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. DHH may be involved in both male gonadal differentiation and perineurial development. DHH binds both Patched and Patched 2 as well as Hedgehog interacting protein (Hip). It induces steroidogenic factor 1(SF1), which is instrumental in promoting Leydig cell differentiation. It also promotes the deposition of basal lamina surrounding seminiferous tubules. | 
                                
                                
                                    | Form : | 
                                    Sterile Filtered White lyophilized (freeze-dried) powder. | 
                                
                                
                                    | Bio-activity : | 
                                    ED50 < 10μg/, measured by its ability to induce alkaline phosphatase production by CCL-226 cells, corresponding to a specific activity of > 100 units/mg. | 
                                
                                
                                    | Molecular Mass : | 
                                    ~20 kDa, observed by reducing SDS-PAGE. | 
                                
                                
                                    | AA Sequence : | 
                                    IIGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG | 
                                
                                
                                    | Endotoxin : | 
                                    < 0.2 EU/μg, determined by LAL method. | 
                                
                                
                                    | Purity : | 
                                    > 95% by SDS-PAGE and HPLC analyses. | 
                                
                                
                                    | Storage : | 
                                    Lyophilized recombinant Human Hedgehog homolog(rhDHH) remains stable up to 6 months at-80 centigrade from date of receipt. Upon reconstitution, rhDHH remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. | 
                                
                                
                                    | Storage Buffer : | 
                                    Lyophilized after extensive dialysis against PBS. | 
                                
                                
                                    | Reconstitution : | 
                                    Reconstituted in ddH2O at 100 μg/mL. |