Active Recombinant Human DHH Protein (177 aa)

Cat.No. : DHH-432D
Product Overview : Recombinant human Desert hedgehog (DHH) produced in E. coli is a single non-glycosylated polypeptide chain containing 177 amino acids. A fully biologically active molecule, rhDHH has a molecular mass of around 20kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 177
Description : Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis. It is predicted to be made as a precursor that is auto-catalytically cleaved; the N-terminal portion is soluble and contains the signaling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. DHH may be involved in both male gonadal differentiation and perineurial development. DHH binds both Patched and Patched 2 as well as Hedgehog interacting protein (Hip). It induces steroidogenic factor 1(SF1), which is instrumental in promoting Leydig cell differentiation. It also promotes the deposition of basal lamina surrounding seminiferous tubules.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 10μg/, measured by its ability to induce alkaline phosphatase production by CCL-226 cells, corresponding to a specific activity of > 100 units/mg.
Molecular Mass : ~20 kDa, observed by reducing SDS-PAGE.
AA Sequence : IIGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant Human Hedgehog homolog(rhDHH) remains stable up to 6 months at-80 centigrade from date of receipt. Upon reconstitution, rhDHH remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name DHH desert hedgehog [ Homo sapiens ]
Official Symbol DHH
Synonyms DHH; desert hedgehog; desert hedgehog (Drosophila) homolog; desert hedgehog protein; HHG 3; MGC35145; mutant desert hedgehog; desert hedgehog homolog; GDXYM; HHG-3; SRXY7;
Gene ID 50846
mRNA Refseq NM_021044
Protein Refseq NP_066382
MIM 605423
UniProt ID O43323

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHH Products

Required fields are marked with *

My Review for All DHH Products

Required fields are marked with *

0
cart-icon
0
compare icon