Recombinant Human DHH protein

Cat.No. : DHH-345H
Product Overview : Recombinant Human DHH protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 177
Description : This gene encodes a member of the hedgehog family. The hedgehog gene family encodes signaling molecules that play an important role in regulating morphogenesis. This protein is predicted to be made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. This protein may be involved in both male gonadal differentiation and perineurial development.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 10mM PB, pH 6.0, 300mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 15-45 μg/ml.
Molecular Mass : Approximately 19.9 kDa, a single non-glycosylated polypeptide chain containing 177 amino acids.
AA Sequence : IIGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Endotoxin : Less than 1 EU/μg of rHuDHH C23II as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name DHH
Official Symbol DHH
Synonyms DHH; desert hedgehog; desert hedgehog (Drosophila) homolog; desert hedgehog protein; HHG 3; MGC35145; mutant desert hedgehog; desert hedgehog homolog; GDXYM; HHG-3; SRXY7;
Gene ID 50846
mRNA Refseq NM_021044
Protein Refseq NP_066382
MIM 605423
UniProt ID O43323

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHH Products

Required fields are marked with *

My Review for All DHH Products

Required fields are marked with *

0
cart-icon
0
compare icon