Active Recombinant Mouse Fgf10 Protein (148 aa)

Cat.No. : Fgf10-420F
Product Overview : Recombinant mouse Fibroblast Growth Factor-10 (rmFGF-10) produced in E. coli is a single non-glycosylated polypeptide chain containing 148 amino acids. A fully biologically active molecule, rmFGF-10 has a molecular mass of 17.0 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 148
Description : Fibroblast Growth Factor-10 (FGF-10) is a mitogen mainly produced by mesenchymal stem cells in lung. FGF-10 belongs to the heparin binding FGF family, and is also known as Keratinocyte Growth Factor-2 (KGF-2). It shares homology with KGF, and both KGF and FGF-10 activate the receptor FGFR2-IIIb. However, unlike KGF, which induces the proliferation and differentiation of various epithelial cells, FGF-10 is an essential factor for the budding and branching morphogenesis during multi-organ development via mesenchymal-epithelial interactions. FGF-10 is crucial for lung and limb development and is regulated by Shh during early development.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 10 ng/mL, measured by a cell proliferation assay using 4MBr-5 cells, corresponding to a specific activity of > 1.0 × 10^5 units/mg.
Molecular Mass : 17.0 kDa, observed by reducing SDS-PAGE.
AA Sequence : SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant mouse Fibroblast Growth Factor-10 (rmFGF-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-10 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Fgf10 fibroblast growth factor 10 [ Mus musculus ]
Official Symbol Fgf10
Synonyms FGF10; fibroblast growth factor 10; keratinocyte growth factor 2; Fgf-10; BB213776;
Gene ID 14165
mRNA Refseq NM_008002
Protein Refseq NP_032028
UniProt ID O35565

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf10 Products

Required fields are marked with *

My Review for All Fgf10 Products

Required fields are marked with *

0
cart-icon