Active Recombinant Mouse Fgf23 Protein
Cat.No. : | Fgf23-7408M |
Product Overview : | Recombinant murine FGF-23 is a 25.5 kDa globular protein containing 228 amino acid residues without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a member of the fibroblast growth factor family. The encoded protein regulates phosphate homeostasis and vitamin D metabolism. Mutation of the related gene in humans causes autosomal dominant hypophosphatemic rickets (ADHR). The secreted protein is further cleaved into N- and C-terminal chains, which results in loss of function. |
Form : | Lyophilized (0.2 μm Sterile filtered) purified protein |
Bio-activity : | Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The expected ED50 for this effect is 0.3-0.5 μg/mL, in the presence of murine Klotho and heparin. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRSAEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV |
Purity : | > 95 % pure by SDS-PAGE and HPLC analyses |
Stability : | Shelf life: one year from despatch. |
Storage : | Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term. After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term. Avoid repeated freezing and thawing. |
Gene Name | Fgf23 fibroblast growth factor 23 [ Mus musculus (house mouse) ] |
Official Symbol | Fgf23 |
Synonyms | Fgf23; fibroblast growth factor 23; Fgf8b; fibroblast growth factor 23; FGF-23; fibroblast growth factor 8b |
Gene ID | 64654 |
mRNA Refseq | NM_022657 |
Protein Refseq | NP_073148 |
UniProt ID | Q9EPC2 |
◆ Recombinant Proteins | ||
Fgf23-835M | Recombinant Mouse Fgf23 protein(Tyr25~Val251), His-tagged | +Inquiry |
Fgf23-417M | Recombinant Mouse Fibroblast Growth Factor 23, Fc Chimera | +Inquiry |
Fgf23-27M | Active Recombinant Mouse Fgf23 | +Inquiry |
FGF23-3586H | Recombinant Human FGF23 Full Length Protein, His tagged | +Inquiry |
FGF23-4112H | Recombinant Human FGF23 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf23 Products
Required fields are marked with *
My Review for All Fgf23 Products
Required fields are marked with *
0
Inquiry Basket