Active Recombinant Mouse Fgf9 Protein (207 aa)
Cat.No. : | Fgf9-405F |
Product Overview : | Recombinant mouse Fibroblast Growth Factor (rmFGF-9) produced in E. coli is a single non-glycosylated polypeptide chain containing 207 amino acids. A fully biologically active molecule, rmFGF-9 has a molecular mass of 23.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 207 |
Description : | Fibroblast Growth Factor-9 (FGF-9) is a pleiotropic cytokine and belongs to the heparin-binding FGF family. Like other members in the family, FGF-9 resembles a β-trefoil structure. FGF-9 undergoes reversible dimerization, a common characteristic shared by its subfamily members, FGF-16 and FGF-20. The mutations involved in the homodimerization also affect the affinity for heparin, binding to FGF receptors, and biological activity. In vivo, FGF-9 is expressed in limb buds, the developing skeleton, and in the intestines during late stage embryogenesis. FGF-9 is essential for the development of heart, lung, kidney, cecum, and testes; and the reduction of FGF-9 level leads to premature differentiation. FGF-9 also works along with Bone Morphogenetic Protein-7 (BMP-7) to promote the survival of nephron progenitors. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 2 × 10^5 units/mg. |
Molecular Mass : | 23.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant mouse Fibroblast Growth Factor (rmFGF-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-9 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Fgf9 fibroblast growth factor 9 [ Mus musculus ] |
Official Symbol | Fgf9 |
Synonyms | FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; elbow knee synostosis; glia activating factor; glia-activating factor; Eks; |
Gene ID | 14180 |
mRNA Refseq | NM_013518 |
Protein Refseq | NP_038546 |
UniProt ID | P54130 |
◆ Recombinant Proteins | ||
FGF9-2336R | Recombinant Rat FGF9 Protein | +Inquiry |
Fgf9-187M | Recombinant Mouse Fgf9 protein, His/S-tagged | +Inquiry |
FGF9-1427H | Recombinant Human FGF9 protein, Fc-tagged | +Inquiry |
FGF9-5969C | Recombinant Chicken FGF9 | +Inquiry |
FGF9-107H | Recombinant Human FGF9 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF9-001CCL | Recombinant Canine FGF9 cell lysate | +Inquiry |
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf9 Products
Required fields are marked with *
My Review for All Fgf9 Products
Required fields are marked with *
0
Inquiry Basket