Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
207 |
Description : |
Fibroblast Growth Factor-9 (FGF-9) is a pleiotropic cytokine and belongs to the heparin-binding FGF family. Like other members in the family, FGF-9 resembles a β-trefoil structure. FGF-9 undergoes reversible dimerization, a common characteristic shared by its subfamily members, FGF-16 and FGF-20. The mutations involved in the homodimerization also affect the affinity for heparin, binding to FGF receptors, and biological activity. In vivo, FGF-9 is expressed in limb buds, the developing skeleton, and in the intestines during late stage embryogenesis. FGF-9 is essential for the development of heart, lung, kidney, cecum, and testes; and the reduction of FGF-9 level leads to premature differentiation. FGF-9 also works along with Bone Morphogenetic Protein-7 (BMP-7) to promote the survival of nephron progenitors. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 5 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 2 × 10^5 units/mg. |
Molecular Mass : |
23.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
Storage : |
Lyophilized recombinant mouse Fibroblast Growth Factor (rmFGF-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-9 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |