Active Recombinant Mouse Fgf9 Protein

Cat.No. : Fgf9-063M
Product Overview : Purified recombinant protein of Mouse fibroblast growth factor 9 (Fgf9) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
Bio-activity : Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is = 10 ng/ml, corresponding to a specific activity of = 1 x 10^5 units/mg.
Molecular Mass : 23.3 kDa
AA Sequence : PLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Fgf9 fibroblast growth factor 9 [ Mus musculus (house mouse) ]
Official Symbol Fgf9
Synonyms Fgf9; fibroblast growth factor 9; Eks; fibroblast growth factor 9; FGF-9; GAF; HBGF-9; elbow knee synostosis; glia-activating factor
Gene ID 14180
mRNA Refseq NM_013518
Protein Refseq NP_038546
UniProt ID P54130

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf9 Products

Required fields are marked with *

My Review for All Fgf9 Products

Required fields are marked with *

0
cart-icon