Active Recombinant Mouse Flt3l Protein, His-Tagged
Cat.No. : | Flt3l-01M |
Product Overview : | Recombinant mouse Flt3l Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Fms-related tyrosine kinase 3 ligand (FLT3LG) is a protein which in humans is encoded by the FLT3LG gene. FLT3 ligand is a receptor for the fl cytokine has a tyrosine-protein kinase activity & a growth factor that regulates proliferation of early hematopoietic cells. Flt3-Ligand synergizes with other CSFs and interleukins to induce growth and differentiation. |
Form : | Lyophilized powder |
AA Sequence : | MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNIS HLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED50 for this effect is <2 ng/mL. |
Purity : | ≥98% as determined by SDS-PAGE and HPLC. Purified by Ni-NTA chromatography. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ] |
Official Symbol | Flt3l |
Synonyms | Ly72L; Flt3lg |
Gene ID | 14256 |
mRNA Refseq | NM_001402831.1 |
Protein Refseq | NP_001389760.1 |
UniProt ID | Q64085 |
◆ Recombinant Proteins | ||
Flt3l-456M | Active Recombinant Mouse Flt3l protein(Met1-Arg188), hFc-tagged | +Inquiry |
FLT3L-99M | Active Recombinant Mouse FLT3L Protein | +Inquiry |
Flt3l-936M | Active Recombinant Mouse Flt3l protein | +Inquiry |
FLT3L-20H | Active Recombinant Human FLT3L, His-tagged | +Inquiry |
FLT3L-1888H | Active Recombinant Human FLT3L protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-1387MCL | Recombinant Mouse FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Flt3l Products
Required fields are marked with *
My Review for All Flt3l Products
Required fields are marked with *
0
Inquiry Basket