Active Recombinant Mouse Flt3l Protein, His-Tagged

Cat.No. : Flt3l-01M
Product Overview : Recombinant mouse Flt3l Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Fms-related tyrosine kinase 3 ligand (FLT3LG) is a protein which in humans is encoded by the FLT3LG gene. FLT3 ligand is a receptor for the fl cytokine has a tyrosine-protein kinase activity & a growth factor that regulates proliferation of early hematopoietic cells. Flt3-Ligand synergizes with other CSFs and interleukins to induce growth and differentiation.
Form : Lyophilized powder
AA Sequence : MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNIS
HLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED50 for this effect is <2 ng/mL.
Purity : ≥98% as determined by SDS-PAGE and HPLC.
Purified by Ni-NTA chromatography.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ]
Official Symbol Flt3l
Synonyms Ly72L; Flt3lg
Gene ID 14256
mRNA Refseq NM_001402831.1
Protein Refseq NP_001389760.1
UniProt ID Q64085

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Flt3l Products

Required fields are marked with *

My Review for All Flt3l Products

Required fields are marked with *

0

Inquiry Basket

cartIcon