Active Recombinant Mouse FLT3L Protein
Cat.No. : | FLT3L-99M |
Product Overview : | Recombinant Mouse FLT3L Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Fms-related tyrosine kinase 3 ligand (FLT-3 ligand) is a growth factor that regulates hematopoietic cell proliferation. FLT-3 ligand signaling is transmitted through the fms-related tyrosine kinase 3 (FLT-3) receptor. FLT-3 ligand promotes the long-term expansion and differentiation of pro-B cells in the presence of interleukin 7 (IL-7) or in combination of IL-7 and interleukin 3 (IL-3). |
Bio-activity : | OCI-AML5 cell proliferation, ≤10 ng/mL; ≥1.0 x 10^5 units/mg |
Molecular Mass : | Monomer, 18.6 kDa (163 aa) |
AA Sequence : | MTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ] |
Official Symbol | FLT3L |
Synonyms | Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand |
Gene ID | 14256 |
mRNA Refseq | NM_013520 |
Protein Refseq | NP_038548 |
UniProt ID | P49772 |
◆ Recombinant Proteins | ||
Flt3l-188M | Recombinant Mouse FMS-like Tyrosine Kinase 3 Ligand | +Inquiry |
Flt3l-936M | Active Recombinant Mouse Flt3l protein | +Inquiry |
Flt3l-3046M | Recombinant Mouse Flt3l Protein, Myc/DDK-tagged | +Inquiry |
Flt3l-10556M | Recombinant Mouse Flt3l Protein, His (Fc)-Avi-tagged | +Inquiry |
Flt3l-285F | Active Recombinant Mouse Flt3l Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-1387MCL | Recombinant Mouse FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLT3L Products
Required fields are marked with *
My Review for All FLT3L Products
Required fields are marked with *
0
Inquiry Basket