Active Recombinant Mouse Il1a Protein (156 aa)
Cat.No. : | Il1a-044I |
Product Overview : | Recombinant Mouse Il1a Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 156 |
Description : | IL-1 alpha is a non-secreted proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.002 ng/mL, corresponding to a specific activity of > 5.0 × 10^8 units/mg. |
Molecular Mass : | Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids. |
AA Sequence : | SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS |
Endotoxin : | Less than 1 EU/mg of rMuIL-1 alpha as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il1a interleukin 1 alpha [ Mus musculus ] |
Official Symbol | Il1a |
Synonyms | IL1A; interleukin 1 alpha; interleukin-1 alpha; IL-1 alpha; Il-1a; |
Gene ID | 16175 |
mRNA Refseq | NM_010554 |
Protein Refseq | NP_034684 |
UniProt ID | P01582 |
◆ Recombinant Proteins | ||
Il1a-75R | Recombinant Rat Il1a protein, His-tagged | +Inquiry |
IL1A-243H | Active Recombinant Human IL1A Protein | +Inquiry |
IL1A-01H | Recombinant Human IL1A protein | +Inquiry |
IL1A-16458H | Recombinant Human IL1A protein, GST-tagged | +Inquiry |
IL1A-134H | Recombinant Human Interleukin 1, Alpha, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il1a Products
Required fields are marked with *
My Review for All Il1a Products
Required fields are marked with *
0
Inquiry Basket