Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Description : |
Interleukin-1 alpha (IL-1α) is a non-secreted proinflammatory cytokine produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. Both IL-1α and IL-1β binds to the same receptor and has similar identical biological properties. Among various species, the amino acid sequence of mature IL-1α is conserved 60 % to 70 % and human IL-1 has been found to be biologically active on murine cell lines. IL-1α recently started to find effective application in cosmetic and dermatological formulations, which allow to significantly harmonizing derma architecture. |
Form : |
Sterile Filtered White lyophil |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 1.0 pg ml, corresponding to a specific activity of > 1.0×10^9 IU/mg. |
Molecular Mass : |
Approximately 18.0 kDa |
AA Sequence : |
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Endotoxin : |
Less than 1.0 EU/μg of rHuIL-1a as determined by LAL method. |
Purity : |
> 97% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. |