Active Recombinant Mouse Il1b Protein

Cat.No. : Il1b-100M
Product Overview : Purified recombinant protein of Mouse interleukin 1 beta (Il1b) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.
Bio-activity : The ED50 as determined by the dose-dependent stimulation of murine D10S cells is less than or equal to 0.002 ng/ml, corresponding to a specific activity of > 5 x 10^8 units/mg.
Molecular Mass : 17.5 kDa
AA Sequence : MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il1b interleukin 1 beta [ Mus musculus (house mouse) ]
Official Symbol Il1b
Synonyms Il1b; interleukin 1 beta; Il-1b; IL-1beta; interleukin-1 beta; IL-1 beta
Gene ID 16176
mRNA Refseq NM_008361
Protein Refseq NP_032387
UniProt ID P10749

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1b Products

Required fields are marked with *

My Review for All Il1b Products

Required fields are marked with *

0
cart-icon