Active Recombinant Mouse Il1b Protein
Cat.No. : | Il1b-100M |
Product Overview : | Purified recombinant protein of Mouse interleukin 1 beta (Il1b) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response. |
Bio-activity : | The ED50 as determined by the dose-dependent stimulation of murine D10S cells is less than or equal to 0.002 ng/ml, corresponding to a specific activity of > 5 x 10^8 units/mg. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il1b interleukin 1 beta [ Mus musculus (house mouse) ] |
Official Symbol | Il1b |
Synonyms | Il1b; interleukin 1 beta; Il-1b; IL-1beta; interleukin-1 beta; IL-1 beta |
Gene ID | 16176 |
mRNA Refseq | NM_008361 |
Protein Refseq | NP_032387 |
UniProt ID | P10749 |
◆ Recombinant Proteins | ||
IL1B-1416M | Recombinant Mouse IL1B protein, GST-tagged | +Inquiry |
IL1B-6353H | Recombinant Human IL1B protein, His-Avi-tagged | +Inquiry |
Il1b-102M | Active Recombinant Mouse Il1b Protein | +Inquiry |
IL1B-366I | Active Recombinant Human IL1B Protein (153 aa) | +Inquiry |
Il1b-463R | Recombinant Rat Il1b protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il1b Products
Required fields are marked with *
My Review for All Il1b Products
Required fields are marked with *
0
Inquiry Basket