Active Recombinant Mouse Il22 Protein (147 aa)
Cat.No. : | Il22-359I |
Product Overview : | Recombinant MouseIL-22 produced in E. coli is a single non-glycosylated polypeptide chain containing 147 amino acids. A fully biologically active molecule, rmIL-22 has a molecular mass of 16.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 147 |
Description : | Interleukin-22 (IL-22) is a member of a group of cytokines called the IL-10 family which include IL-10,IL-19, IL-20, IL-24, and IL-26. IL-22 shares use of the IL-10R2 in cell signaling with other members of this family IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. IL-22 is produced by activated DCs and T cells and initiates an innate immune response against bacterial pathogens especially in epithelial cells such as those in the respiratory tract and gut. IL-22 along with IL-17 is rapidly produced by splenic LTi-like cells and can also be produced by Th17 cells, which plays a likely role in the coordinated response of both adaptive and innate immune systems. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 ng/mL. Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). |
Molecular Mass : | 16.8 kDa, observed by reducing SDS-PAGE |
AA Sequence : | MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE& HPLC. |
Storage : | Lyophilized recombinant Mouse IL-22 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse IL-22 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il22 interleukin 22 [ Mus musculus ] |
Official Symbol | Il22 |
Synonyms | IL22; interleukin 22; interleukin-22; ILTIF alpha; IL-TIF alpha; interleukin-22a; IL-10-related T-cell-derived-inducible factor; interleukin 10-related T cell-derived inducible factor; IL-22; Iltif; IL-22a; ILTIFa; MGC129416; MGC129417; |
Gene ID | 50929 |
mRNA Refseq | NM_016971 |
Protein Refseq | NP_058667 |
UniProt ID | Q14BB3 |
◆ Recombinant Proteins | ||
Il22-3514M | Active Recombinant Mouse Il22 Protein | +Inquiry |
IL22-90M | Recombinant Mouse IL-22 | +Inquiry |
IL22-098I | Active Recombinant Human IL22 Protein (146 aa) | +Inquiry |
IL22-360I | Active Recombinant Human IL22 Protein (147 aa) | +Inquiry |
IL22-105M | Active Recombinant Mouse IL22 Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il22 Products
Required fields are marked with *
My Review for All Il22 Products
Required fields are marked with *
0
Inquiry Basket