Active Recombinant Mouse Il22 Protein (147 aa)

Cat.No. : Il22-359I
Product Overview : Recombinant MouseIL-22 produced in E. coli is a single non-glycosylated polypeptide chain containing 147 amino acids. A fully biologically active molecule, rmIL-22 has a molecular mass of 16.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 147
Description : Interleukin-22 (IL-22) is a member of a group of cytokines called the IL-10 family which include IL-10,IL-19, IL-20, IL-24, and IL-26. IL-22 shares use of the IL-10R2 in cell signaling with other members of this family IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. IL-22 is produced by activated DCs and T cells and initiates an innate immune response against bacterial pathogens especially in epithelial cells such as those in the respiratory tract and gut. IL-22 along with IL-17 is rapidly produced by splenic LTi-like cells and can also be produced by Th17 cells, which plays a likely role in the coordinated response of both adaptive and innate immune systems.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 ng/mL. Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells).
Molecular Mass : 16.8 kDa, observed by reducing SDS-PAGE
AA Sequence : MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 98% as analyzed by SDS-PAGE& HPLC.
Storage : Lyophilized recombinant Mouse IL-22 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse IL-22 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Il22 interleukin 22 [ Mus musculus ]
Official Symbol Il22
Synonyms IL22; interleukin 22; interleukin-22; ILTIF alpha; IL-TIF alpha; interleukin-22a; IL-10-related T-cell-derived-inducible factor; interleukin 10-related T cell-derived inducible factor; IL-22; Iltif; IL-22a; ILTIFa; MGC129416; MGC129417;
Gene ID 50929
mRNA Refseq NM_016971
Protein Refseq NP_058667
UniProt ID Q14BB3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il22 Products

Required fields are marked with *

My Review for All Il22 Products

Required fields are marked with *

0
cart-icon