Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
147 |
Description : |
Interleukin-22 (IL-22) is a member of a group of cytokines called the IL-10 family which include IL-10,IL-19, IL-20, IL-24, and IL-26. IL-22 shares use of the IL-10R2 in cell signaling with other members of this family IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. IL-22 is produced by activated DCs and T cells and initiates an innate immune response against bacterial pathogens especially in epithelial cells such as those in the respiratory tract and gut. IL-22 along with IL-17 is rapidly produced by splenic LTi-like cells and can also be produced by Th17 cells, which plays a likely role in the coordinated response of both adaptive and innate immune systems. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 0.5 ng/mL. Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). |
Molecular Mass : |
16.8 kDa, observed by reducing SDS-PAGE |
AA Sequence : |
MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 98% as analyzed by SDS-PAGE& HPLC. |
Storage : |
Lyophilized recombinant Mouse IL-22 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse IL-22 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |