Active Recombinant Mouse Il22 Protein

Cat.No. : Il22-146M
Product Overview : Purified recombinant protein of Mouse interleukin 22 (Il22) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine that contributes to the inflammatory response in vivo.
Bio-activity : Assay#1: Determined by its ability to activate STAT following receptor ligand interaction. Assay#2:Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). The expected ED50 for this effect is 1.0-2.0 ng/ml.
Molecular Mass : 22.4 kDa
AA Sequence : MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il22 interleukin 22 [ Mus musculus (house mouse) ]
Official Symbol Il22
Synonyms Il22; interleukin 22; IL-22; Iltif; IL-22a; ILTIFa; interleukin-22; IL-10-related T-cell-derived-inducible factor; IL-TIF alpha; ILTIF alpha; interleukin 10-related T cell-derived inducible factor; interleukin-22a
Gene ID 50929
mRNA Refseq NM_016971
Protein Refseq NP_058667
UniProt ID Q9JJY9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il22 Products

Required fields are marked with *

My Review for All Il22 Products

Required fields are marked with *

0
cart-icon