Active Recombinant Mouse Il4 Protein (120 aa)
Cat.No. : | Il4-025I |
Product Overview : | Recombinant Mouse Il4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 120 |
Description : | Interleukin-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant prolifiration of Murine HT-2 cells is less then 2 ng/mL, corresponding to a Specific Activity of >5 × 10^5 IU/mg. |
Molecular Mass : | Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 120 amino acids. |
AA Sequence : | MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Endotoxin : | Less than 1 EU/mg of rmIL-4 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il4 interleukin 4 [ Mus musculus ] |
Official Symbol | Il4 |
Synonyms | IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1; |
Gene ID | 16189 |
mRNA Refseq | NM_021283 |
Protein Refseq | NP_067258 |
UniProt ID | P07750 |
◆ Recombinant Proteins | ||
IL4-42H | Recombinant Human IL4 Protein | +Inquiry |
Il4-2318G | Recombinant Guinea pig Il4 Protein, His-tagged | +Inquiry |
Il4-110M | Active Recombinant Mouse Il4 Protein | +Inquiry |
IL4-139H | Recombinant Human IL4 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL4-99H | Recombinant Human IL4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il4 Products
Required fields are marked with *
My Review for All Il4 Products
Required fields are marked with *
0
Inquiry Basket