Species : |
Mouse |
Source : |
E.coli |
Tag : |
His |
Description : |
The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Form : |
Powder |
Bio-activity : |
Determined by its ability to induce HT-2 cells proliferation. The ED50 for this effect is < 1 ng/mL. The specific activity of recombinant mouse IL-4 is approximately > 1 x 10^6 IU/mg. |
AA Sequence : |
MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Endotoxin : |
Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : |
> 98% (by SDS-PAGE) |
Applications : |
SDS-PAGE |
Notes : |
For laboratory research only, not for drug, diagnostic or other use. |
Storage : |
Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : |
PBS (pH 7.4) |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |