Active Recombinant Mouse Il4 Protein

Cat.No. : Il4-634M
Product Overview : Recombinant Mouse Il4 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : Interleukin-4 (IL-4) is a pleiotropic cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. It is produced by mast cells, activated T cells and bone marrow stromal cells. It has many biological roles, including the stimulation of activated B-cell and T-cell proliferation, and the differentiation of CD4+ T-cells into Th2 cells. In addition, IL-4 enhances both secretion and cell surface expression of IgE and IgG1 and also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. The mouse IL-4 has a compact, globular fold, stabilised by 3 disulphide bonds and contains 121 amino acids residues which is a single non-glycosylated polypeptide. The human IL-4 shares about 40% aa sequence identity with mouse rat IL-4 and they are species-specific in their activities.
Form : Sterile Filtered White lyophil
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant prolifiration of Murine HT-2 cells is less then 2 ng/mL, corresponding to a Specific Activity of > 5×10^5 IU/mg.
Molecular Mass : Approximately 13.5 kDa
AA Sequence : MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Endotoxin : Less than 1 EU/μg of rMuIL-4 as determined by LAL method.
Purity : > 97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.
Gene Name Il4 interleukin 4 [ Mus musculus (house mouse) ]
Official Symbol Il4
Synonyms IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1;
Gene ID 16189
mRNA Refseq NM_021283
Protein Refseq NP_067258
UniProt ID P07750

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il4 Products

Required fields are marked with *

My Review for All Il4 Products

Required fields are marked with *

0
cart-icon