Recombinant Sheep IL4 Protein, His-B2M/MYC-tagged

Cat.No. : IL4-1258S
Product Overview : Recombinant Sheep IL4 Protein (25-135aa) was expressed in E. coli with N-terminal His-B2M and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Sheep
Source : E.coli
Tag : B2M&His&Myc
Protein Length : 25-135 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 29.6 kDa
AA Sequence : HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLD
RNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name IL4 interleukin 4 [ Ovis aries (sheep) ]
Official Symbol IL4
Synonyms IL4; IL-4; interleukin 4; B-cell stimulatory factor 1; BSF-1; lymphocyte stimulatory factor 1
Gene ID 443327
mRNA Refseq NM_001009313.2
Protein Refseq NP_001009313.2
UniProt ID P30368

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL4 Products

Required fields are marked with *

My Review for All IL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon