Recombinant Sheep IL4 Protein, His-B2M/MYC-tagged
| Cat.No. : | IL4-1258S |
| Product Overview : | Recombinant Sheep IL4 Protein (25-135aa) was expressed in E. coli with N-terminal His-B2M and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sheep |
| Source : | E.coli |
| Tag : | B2M&His&Myc |
| Protein Length : | 25-135 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 29.6 kDa |
| AA Sequence : | HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLD RNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | IL4 interleukin 4 [ Ovis aries (sheep) ] |
| Official Symbol | IL4 |
| Synonyms | IL4; IL-4; interleukin 4; B-cell stimulatory factor 1; BSF-1; lymphocyte stimulatory factor 1 |
| Gene ID | 443327 |
| mRNA Refseq | NM_001009313.2 |
| Protein Refseq | NP_001009313.2 |
| UniProt ID | P30368 |
| ◆ Recombinant Proteins | ||
| IL4-18B | Active Recombinant Bovine IL-4 | +Inquiry |
| IL4-1177H | Recombinant Human IL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL4-0174C | Active Recombinant Cynomolgus IL4 protein, Fc-tagged | +Inquiry |
| IL4-017H | Recombinant Hamster IL4 Protein, Met1-Phe147, C-His tagged | +Inquiry |
| Il4-11M | Recombinant Mouse Il4 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
