Recombinant Dog IL4 protein, His-tagged
Cat.No. : | IL4-3104D |
Product Overview : | Recombinant Dog IL4 protein(O77762)(25-132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-132aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.8 kDa |
AA Sequence : | HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IL4 interleukin 4 [ Canis lupus familiaris ] |
Official Symbol | IL4 |
Synonyms | IL4; interleukin 4; interleukin-4; BSF-1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; IL-4; |
Gene ID | 403785 |
mRNA Refseq | NM_001003159 |
Protein Refseq | NP_001003159 |
◆ Recombinant Proteins | ||
IL4-151H | Recombinant Human IL4 Protein, C-Term, Tag Free, Biotinylated | +Inquiry |
IL4-139H | Recombinant Human IL4 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL4-279H | Recombinant Human IL4, StrepII-tagged | +Inquiry |
IL4-242I | Active Recombinant Pig IL4 Protein | +Inquiry |
IL4-958M | Active Recombinant Mouse IL4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
0
Inquiry Basket