Recombinant Dog IL4 protein, His-tagged
| Cat.No. : | IL4-3104D |
| Product Overview : | Recombinant Dog IL4 protein(O77762)(25-132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-132aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.8 kDa |
| AA Sequence : | HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IL4 interleukin 4 [ Canis lupus familiaris ] |
| Official Symbol | IL4 |
| Synonyms | IL4; interleukin 4; interleukin-4; BSF-1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; IL-4; |
| Gene ID | 403785 |
| mRNA Refseq | NM_001003159 |
| Protein Refseq | NP_001003159 |
| ◆ Recombinant Proteins | ||
| IL4-1557H | Recombinant human IL4, Active, His-tagged | +Inquiry |
| Il4-297M | Active Recombinant Mouse Il4 | +Inquiry |
| IL4-3105H | Recombinant Human IL4 protein, His-SUMO-tagged | +Inquiry |
| Il4-243I | Active Recombinant Mouse Il4 Protein | +Inquiry |
| Il4-5705M | Recombinant Mouse Il4 Protein (His21-Ser140), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *



