Active Recombinant Mouse Il5 Protein
Cat.No. : | Il5-112M |
Product Overview : | Purified recombinant protein of Mouse interleukin 5 (Il5) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. |
Bio-activity : | ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is > 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5units/mg. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il5 interleukin 5 [ Mus musculus (house mouse) ] |
Official Symbol | Il5 |
Synonyms | Il5; interleukin 5; Il-5; interleukin-5; B-cell growth factor II; BCGF-II; T-cell replacing factor; TRF; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor |
Gene ID | 16191 |
mRNA Refseq | NM_010558 |
Protein Refseq | NP_034688 |
UniProt ID | P04401 |
◆ Recombinant Proteins | ||
IL5-003D | Active Recombinant Dog IL5 Protein, His-tagged | +Inquiry |
Il5-2095R | Recombinant Rat Il5 protein | +Inquiry |
IL5-412M | Active Recombinant Mouse Interleukin-5 | +Inquiry |
IL5-2074R | Recombinant Rhesus Macaque IL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL5-2574H | Recombinant Human IL5 Protein (Ile20-Ser134), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il5 Products
Required fields are marked with *
My Review for All Il5 Products
Required fields are marked with *