Active Recombinant Dog IL5 Protein, His-tagged
| Cat.No. : | IL5-003D |
| Product Overview : | Recombinant canine IL-5, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | Insect cells |
| Tag : | His |
| Description : | Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. |
| Form : | Liquid |
| Bio-activity : | Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 range ≤ 15 ng/mL. |
| Molecular Mass : | 13.9 kDa |
| AA Sequence : | VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -82 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | IL5 interleukin 5 [ Canis lupus familiaris (dog) ] |
| Official Symbol | IL5 |
| Synonyms | IL5; interleukin 5; interleukin-5; IL-5; T-cell replacing factor; TRF; eosinophil differentiation factor; interleukin 5 (colony-stimulating factor, eosinophil) |
| Gene ID | 403790 |
| mRNA Refseq | NM_001006950 |
| Protein Refseq | NP_001006951 |
| UniProt ID | Q95J76 |
| ◆ Recombinant Proteins | ||
| IL5-5178H | Recombinant Human IL5 Protein, GST-tagged | +Inquiry |
| IL5-257E | Recombinant Equine Interleukin 5 (Colony-Stimulating Factor, Eosinophil) | +Inquiry |
| Il5-755M | Recombinant Mouse Il5 protein(Met1-Gly133), His-tagged | +Inquiry |
| IL5-76H | Active Recombinant Human IL5 protein, His-tagged | +Inquiry |
| Il5-206M | Recombinant Mouse Il5 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
| IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL5 Products
Required fields are marked with *
My Review for All IL5 Products
Required fields are marked with *
