Active Recombinant Dog IL5 Protein, His-tagged

• Cat.No.: IL5-003D
• Product Overview: Recombinant canine IL-5, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Dog
• Source: Insect cells
• Tag: His
• Description: Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
• Form: Liquid
• Bio-activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 range ≤ 15 ng/mL.
• Molecular Mass: 13.9 kDa
• AA Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -82 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: IL5 interleukin 5 [ Canis lupus familiaris (dog) ]
• Official Symbol: IL5
• Synonyms: IL5; interleukin 5; interleukin-5; IL-5; T-cell replacing factor; TRF; eosinophil differentiation factor; interleukin 5 (colony-stimulating factor, eosinophil)
• Gene ID: 403790
• mRNA Refseq: NM_001006950
• Protein Refseq: NP_001006951
• UniProt ID: Q95J76