Active Recombinant Dog IL5 Protein, His-tagged
Cat.No. : | IL5-003D |
Product Overview : | Recombinant canine IL-5, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | Insect cells |
Tag : | His |
Description : | Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 range ≤ 15 ng/mL. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -82 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | IL5 interleukin 5 [ Canis lupus familiaris (dog) ] |
Official Symbol | IL5 |
Synonyms | IL5; interleukin 5; interleukin-5; IL-5; T-cell replacing factor; TRF; eosinophil differentiation factor; interleukin 5 (colony-stimulating factor, eosinophil) |
Gene ID | 403790 |
mRNA Refseq | NM_001006950 |
Protein Refseq | NP_001006951 |
UniProt ID | Q95J76 |
◆ Recombinant Proteins | ||
IL5-43H | Recombinant Human IL5 Protein | +Inquiry |
Il5-207M | Recombinant Active Mouse IL5 Protein, His-tagged(C-ter) | +Inquiry |
Il5-112M | Active Recombinant Mouse Il5 Protein | +Inquiry |
IL5-051HB | Recombinant Human IL5 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL5-269H | Recombinant Human IL5, StrepII-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL5 Products
Required fields are marked with *
My Review for All IL5 Products
Required fields are marked with *
0
Inquiry Basket