Recombinant Rat Il5 protein
Cat.No. : | Il5-2095R |
Product Overview : | Recombinant Rat Il5 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 113 |
Description : | IL-5, also named B-cell differentiation factor I, eosinophil differentiation factor and TRF, is belonging to the cytokine family and the IL-5 gene is in close proximity to the genes encoding IL-3, IL-4, and granulocyte-macrophage colony-stimulating factor (GM-CSF), which are often co-expressed in TH2 cells. Through binding to the IL-5 receptor, IL-5 stimulates B cell growth and increases immunroglobulin secretion. It is also a key mediator in eosinophil activation. Interleukin-5 has long been associated with the cause of several allergic diseases including allergic rhinitis and asthma.Rat IL-5 is a 132-amino acid (115 in human, 133 in the mouse) -long TH2 cytokine that is part of the hematopoietic family. Unlike other members of this cytokine family (namely IL-3 and GM-CSF), this glycoprotein in its active form is a homodimer. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 26.2 kDa, a disulfide-linked homodimeric protein containing two 113 amino acids. |
AA Sequence : | MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV |
Endotoxin : | Less than 1 EU/μg of rRtIL-5 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il5 |
Official Symbol | Il5 |
Synonyms | B-cell Differentiation Factor I, Eosinophil Differentiation Factor, TRF |
Gene ID | 24497 |
mRNA Refseq | NM_021834 |
Protein Refseq | NP_068606 |
UniProt ID | Q08125 |
◆ Recombinant Proteins | ||
Il5-352I | Active Recombinant Rat Il5 Protein (113 aa) | +Inquiry |
IL5-127H | Recombinant Human IL5(Ile20-Ser134) Protein, C-mFc-tagged | +Inquiry |
Il5-238I | Active Recombinant Rat Il5 Protein | +Inquiry |
IL5-1914R | Active Recombinant Rabbit IL5 protein, His-tagged | +Inquiry |
IL5-1735C | Recombinant Chicken IL5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il5 Products
Required fields are marked with *
My Review for All Il5 Products
Required fields are marked with *
0
Inquiry Basket