Active Recombinant Mouse Il7 Protein

Cat.No. : Il7-117M
Product Overview : Purified recombinant protein of Mouse interleukin 7 (Il7) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms.
Bio-activity : The ED50 as determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is< 0.2 ng/ml, corresponding to a specific activity of≥ 5 x 10^6 units/mg.
Molecular Mass : 15 kDa
AA Sequence : MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il7 interleukin 7 [ Mus musculus (house mouse) ]
Official Symbol Il7
Synonyms Il7; interleukin 7; Il-7; hlb368; A630026I06Rik; interleukin-7
Gene ID 16196
mRNA Refseq NM_008371
Protein Refseq NP_032397
UniProt ID P10168

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il7 Products

Required fields are marked with *

My Review for All Il7 Products

Required fields are marked with *

0
cart-icon