Active Recombinant Mouse Il7 Protein, His-tagged
| Cat.No. : | Il7-233I |
| Product Overview : | Recombinant Mouse Il7 Protein with His tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | CHO |
| Tag : | His |
| Description : | Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor,a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor.IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50< 0.4 ng/mL, measured in a cell proliferation assay using 2E8 cells. |
| Molecular Mass : | 8-28kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant murine Interleukin-7 (IL-7), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-7 (IL-7), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | Il7 interleukin 7 [ Mus musculus ] |
| Official Symbol | Il7 |
| Synonyms | IL7; interleukin 7; interleukin-7; Il-7; hlb368; A630026I06Rik; MGC129342; |
| Gene ID | 16196 |
| mRNA Refseq | NM_008371 |
| Protein Refseq | NP_032397 |
| UniProt ID | P10168 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il7 Products
Required fields are marked with *
My Review for All Il7 Products
Required fields are marked with *



