Active Recombinant Mouse Il7 Protein, His-tagged

Cat.No. : Il7-233I
Product Overview : Recombinant Mouse Il7 Protein with His tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : CHO
Tag : His
Description : Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor,a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor.IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.4 ng/mL, measured in a cell proliferation assay using 2E8 cells.
Molecular Mass : 8-28kDa, observed by reducing SDS-PAGE.
AA Sequence : ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant murine Interleukin-7 (IL-7), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-7 (IL-7), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Il7 interleukin 7 [ Mus musculus ]
Official Symbol Il7
Synonyms IL7; interleukin 7; interleukin-7; Il-7; hlb368; A630026I06Rik; MGC129342;
Gene ID 16196
mRNA Refseq NM_008371
Protein Refseq NP_032397
UniProt ID P10168

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il7 Products

Required fields are marked with *

My Review for All Il7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon