Recombinant Mouse Il9 protein
Cat.No. : | Il9-78M |
Product Overview : | Recombinant Mouse Il9 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 126 |
Description : | The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine TS1 cells is less than 0.02 ng/ml, corresponding to a specific activity of > 5.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 14.2 kDa, a single non-glycosylated polypeptide chain containing 126 amino acids. |
AA Sequence : | QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP |
Endotoxin : | Less than 0.1 EU/μg of rMuIL-9 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il9 |
Official Symbol | Il9 |
Synonyms | IL9; interleukin 9; interleukin-9; cytokine P40; T-cell growth factor P40; P40; Il-9; |
Gene ID | 16198 |
mRNA Refseq | NM_008373 |
Protein Refseq | NP_032399 |
UniProt ID | P15247 |
◆ Recombinant Proteins | ||
Il9-001H | Active Recombinant Human Il9, HIgG1 Fc-tagged, mutant | +Inquiry |
IL9-4291H | Recombinant Human IL9 Protein (Met1-Ile144), C-His tagged | +Inquiry |
IL9-151H | Recombinant Human IL9 Protein, DYKDDDDK-tagged | +Inquiry |
IL9-4743H | Recombinant Human IL9 protein, hFc-tagged | +Inquiry |
IL9-1539M | Recombinant Mouse IL9 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il9 Products
Required fields are marked with *
My Review for All Il9 Products
Required fields are marked with *
0
Inquiry Basket