Active Recombinant Mouse Lgals4 Protein, His-tagged
Cat.No. : | Lgals4-7261M |
Product Overview : | Recombinant mouse Lgals4 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-326 |
Description : | Galectin that binds lactose and a related range of sugars. |
Form : | Liquid |
Bio-activity : | The ED50 for this effect is 3.9–7.8 μg/mL, measured by its ability to agglutinate human red blood cells. Biological assay: 1. Mix equal volumes of human blood and Alsever’s solution (pH 7.0). (Alsever’s solution: NaCl 0.42 g, Sodium citric acid 0.8 g, Citric acid 0.055 g, D-glucose 2.05 g in DW100 mL). 2. Centrifuge at 15000 rpm for 10 minutes and wash four times with PBS. 3. Dilute packed cells in a 0.5 mg/mL trypsin-EDTA solution to give 4% red cell suspension. 4. Incubate for 1 h at 37 centigrade and wash four times with PBS. 5. Dilute packed cells in PBS to give 4% red cell suspension. 6. Load 50 μL of 0.5% BSA-in-0.15 M-NaCl solution and 25 μL of 4% Red cell-in-PBS in U shaped wells. 7. Add 25 μL of serial diluted galectin protein in PBS to each well plate. (Round bottom 96 well plate). 8. Incubate for 30 min at room temperature to observe visible agglutination. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 10 % glycerol, 1 mM DTT |
Gene Name | Lgals4 lectin, galactose binding, soluble 4 [ Mus musculus (house mouse) ] |
Official Symbol | Lgals4 |
Synonyms | Lgals4; lectin, galactose binding, soluble 4; gal-4; galect; galectin-4; lactose-binding lectin 4 |
Gene ID | 16855 |
mRNA Refseq | NM_010706 |
Protein Refseq | NP_034836 |
UniProt ID | Q8K419 |
◆ Recombinant Proteins | ||
Lgals4-7261M | Active Recombinant Mouse Lgals4 Protein, His-tagged | +Inquiry |
Lgals4-416R | Recombinant Rat Lgals4 Protein, His-tagged | +Inquiry |
Lgals4-3167R | Recombinant Rat Lgals4 protein, His-SUMO-tagged | +Inquiry |
LGALS4-3389R | Recombinant Rat LGALS4 Protein | +Inquiry |
LGALS4-229H | Recombinant Active Human LGALS4 Protein, His-tagged(N-ter) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgals4 Products
Required fields are marked with *
My Review for All Lgals4 Products
Required fields are marked with *