Active Recombinant Mouse Lgals4 Protein, His-tagged

Cat.No. : Lgals4-7261M
Product Overview : Recombinant mouse Lgals4 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-326
Description : Galectin that binds lactose and a related range of sugars.
Form : Liquid
Bio-activity : The ED50 for this effect is 3.9–7.8 μg/mL, measured by its ability to agglutinate human red blood cells.
Biological assay:
1. Mix equal volumes of human blood and Alsever’s solution (pH 7.0). (Alsever’s solution: NaCl 0.42 g, Sodium citric acid 0.8 g, Citric acid 0.055 g, D-glucose 2.05 g in DW100 mL).
2. Centrifuge at 15000 rpm for 10 minutes and wash four times with PBS.
3. Dilute packed cells in a 0.5 mg/mL trypsin-EDTA solution to give 4% red cell suspension.
4. Incubate for 1 h at 37 centigrade and wash four times with PBS.
5. Dilute packed cells in PBS to give 4% red cell suspension.
6. Load 50 μL of 0.5% BSA-in-0.15 M-NaCl solution and 25 μL of 4% Red cell-in-PBS in U shaped wells.
7. Add 25 μL of serial diluted galectin protein in PBS to each well plate. (Round bottom 96 well plate).
8. Incubate for 30 min at room temperature to observe visible agglutination.
Molecular Mass : 38.8 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 10 % glycerol, 1 mM DTT
Gene Name Lgals4 lectin, galactose binding, soluble 4 [ Mus musculus (house mouse) ]
Official Symbol Lgals4
Synonyms Lgals4; lectin, galactose binding, soluble 4; gal-4; galect; galectin-4; lactose-binding lectin 4
Gene ID 16855
mRNA Refseq NM_010706
Protein Refseq NP_034836
UniProt ID Q8K419

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lgals4 Products

Required fields are marked with *

My Review for All Lgals4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon