Recombinant Rat Lgals4 protein, His-SUMO-tagged

Cat.No. : Lgals4-3167R
Product Overview : Recombinant Rat Lgals4 protein(P38552)(1-324aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 1-324aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 52.3 kDa
AA Sequence : MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Lgals4 lectin, galactoside-binding, soluble, 4 [ Rattus norvegicus ]
Official Symbol Lgals4
Synonyms LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; gal-4; L36LBP; lactose-binding lectin 4; L-36 lactose-binding protein; Lectin galactose binding soluble 4 (Galectin-4); Lectin, galactose binding, soluble 4 (Galectin-4); lectin, galactoside-binding, soluble, 4 (galectin 4); L-36; L36LBI;
Gene ID 25474
mRNA Refseq NM_012975
Protein Refseq NP_037107

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lgals4 Products

Required fields are marked with *

My Review for All Lgals4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon