Recombinant Rat Lgals4 protein, His-SUMO-tagged
Cat.No. : | Lgals4-3167R |
Product Overview : | Recombinant Rat Lgals4 protein(P38552)(1-324aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-324aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.3 kDa |
AA Sequence : | MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Lgals4 lectin, galactoside-binding, soluble, 4 [ Rattus norvegicus ] |
Official Symbol | Lgals4 |
Synonyms | LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; gal-4; L36LBP; lactose-binding lectin 4; L-36 lactose-binding protein; Lectin galactose binding soluble 4 (Galectin-4); Lectin, galactose binding, soluble 4 (Galectin-4); lectin, galactoside-binding, soluble, 4 (galectin 4); L-36; L36LBI; |
Gene ID | 25474 |
mRNA Refseq | NM_012975 |
Protein Refseq | NP_037107 |
◆ Recombinant Proteins | ||
LGALS4-326M | Recombinant Mouse LGALS4 protein, His-tagged | +Inquiry |
LGALS4-4438H | Recombinant Human LGALS4 Protein (Ala2-Ile323), N-His tagged | +Inquiry |
Lgals4-3167R | Recombinant Rat Lgals4 protein, His-SUMO-tagged | +Inquiry |
LGALS4-10H | Active Recombinant Human LGALS4 protein, His-tagged | +Inquiry |
Lgals4-5678M | Active Recombinant Mouse Lectin, Galactose Binding, Soluble 4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgals4 Products
Required fields are marked with *
My Review for All Lgals4 Products
Required fields are marked with *
0
Inquiry Basket