Active Recombinant Mouse Pdgfaa Protein (125 aa)
Cat.No. : | Pdgfa-317P |
Product Overview : | Recombinant Mouse Platelet-Derived Growth Factor-AA(PDGF-AA) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 125 amino acids each. A fully biologically active molecule, rmPDGF-AA has a molecular mass of 28.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 125 |
Description : | Platelet-Derived Growth Factor-AA (PDGF-AA) is one of five dimers (PDGF-AA, AB, BB, CC, and DD) formed by 4 different PDGF subunits. In chemical terms, platelet-derived growth factor is a dimeric glycoprotein composed of two A (-AA) or two B (-BB) chains or a combination of the two (-AB). The dimeric isoforms PDGFAA, AB and BB are differentially expressed in various cell types, and their effects are mediated through two distinct receptors termed α and β. Differences exist in isoform binding to each receptor. Ingeneral, PDGF isoforms are potent mitogens for connective tissue cells including dermal fibroblasts, glial cells, arterial smooth muscle cells and some epithelial andendothelial cells. In addition to its activity as a mitogen, PDGF is chemotactic for fibroblasts, smooth muscle cells, neutrophils and mononuclear cells. PDGF-AA plays a significant role in blood vessel formation (angiogenesis). |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 50 ng/, measured in a cell proliferation assay using 3T3 cells. |
Molecular Mass : | 28.7 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Mouse Platelet-Derived Growth Factor-AA(PDGF-AA)remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Mouse PDGF-AA should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 1xPBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Pdgfa platelet derived growth factor, alpha [ Mus musculus ] |
Official Symbol | Pdgfa |
Synonyms | PDGFA; platelet derived growth factor, alpha; platelet-derived growth factor subunit A; PDGF-1; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha polypeptide; |
Gene ID | 18590 |
mRNA Refseq | NM_008808 |
Protein Refseq | NP_032834 |
UniProt ID | P20033 |
◆ Recombinant Proteins | ||
PDGFA-2569H | Recombinant Human PDGFA Protein, His-tagged | +Inquiry |
Pdgfa-304M | Active Recombinant Mouse Pdgfa | +Inquiry |
PDGFA-375H | Active Recombinant Human Platelet-derived Growth Factor AA | +Inquiry |
PDGFA-101H | Active Recombinant Human PDGFA | +Inquiry |
Pdgfa-175M | Recombinant Mouse Pdgfa protein, His/S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pdgfa Products
Required fields are marked with *
My Review for All Pdgfa Products
Required fields are marked with *
0
Inquiry Basket