Active Recombinant Mouse Pdgfaa Protein (125 aa)

Cat.No. : Pdgfa-317P
Product Overview : Recombinant Mouse Platelet-Derived Growth Factor-AA(PDGF-AA) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 125 amino acids each. A fully biologically active molecule, rmPDGF-AA has a molecular mass of 28.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 125
Description : Platelet-Derived Growth Factor-AA (PDGF-AA) is one of five dimers (PDGF-AA, AB, BB, CC, and DD) formed by 4 different PDGF subunits. In chemical terms, platelet-derived growth factor is a dimeric glycoprotein composed of two A (-AA) or two B (-BB) chains or a combination of the two (-AB). The dimeric isoforms PDGF­AA, AB and BB are differentially expressed in various cell types, and their effects are mediated through two distinct receptors termed α and β. Differences exist in isoform binding to each receptor. Ingeneral, PDGF isoforms are potent mitogens for connective tissue cells including dermal fibroblasts, glial cells, arterial smooth muscle cells and some epithelial andendothelial cells. In addition to its activity as a mitogen, PDGF is chemotactic for fibroblasts, smooth muscle cells, neutrophils and mononuclear cells. PDGF-AA plays a significant role in blood vessel formation (angiogenesis).
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 50 ng/, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass : 28.7 kDa, observed by reducing SDS-PAGE.
AA Sequence : MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Mouse Platelet-Derived Growth Factor-AA(PDGF-AA)remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Mouse PDGF-AA should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 1xPBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Pdgfa platelet derived growth factor, alpha [ Mus musculus ]
Official Symbol Pdgfa
Synonyms PDGFA; platelet derived growth factor, alpha; platelet-derived growth factor subunit A; PDGF-1; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha polypeptide;
Gene ID 18590
mRNA Refseq NM_008808
Protein Refseq NP_032834
UniProt ID P20033

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pdgfa Products

Required fields are marked with *

My Review for All Pdgfa Products

Required fields are marked with *

0

Inquiry Basket

cartIcon