Active Recombinant Rat Csf2 Protein (128 aa)
Cat.No. : | Csf2-012C |
Product Overview : | Recombinant Rat Csf2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 128 |
Description : | GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in by endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of Murine FDC-P1 cells is < 0.01 ng/mL, corresponding to a specific activity of > 1.0 × 10^8 units/mg. |
Molecular Mass : | Recombinant rat GM-CSF is a 14.5 kDa globular protein consisting of 128 amino acids residues. |
AA Sequence : | MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK |
Endotoxin : | Less than 1 EU/mg of rr GM-CSF as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Rattus norvegicus ] |
Official Symbol | Csf2 |
Synonyms | CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; colony-stimulating factor; Gmcsf; Gm-csf; |
Gene ID | 116630 |
mRNA Refseq | NM_053852 |
Protein Refseq | NP_446304 |
UniProt ID | P48750 |
◆ Recombinant Proteins | ||
CSF2-025E | Active Recombinant Human CSF2 (18 - 144aa) | +Inquiry |
Csf2-7177M | Recombinant Mouse Csf2 Protein | +Inquiry |
CSF2-2735S | Recombinant Sheep CSF2 Protein, His&GST-tagged | +Inquiry |
CSF2-43C | Active Recombinant Canine CSF2 Protein | +Inquiry |
Csf2-4346R | Recombinant Rat Csf2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf2 Products
Required fields are marked with *
My Review for All Csf2 Products
Required fields are marked with *
0
Inquiry Basket