Species : |
Rat |
Source : |
E.coli |
Protein Length : |
160 |
Description : |
Interleukin-10 also known as cytokine synthesis inhibitory factor (CSIF), is coded by IL10 gene on chromosome 13 in rat. the charter member of the IL 10 family of α helical cytokines that also includes IL19, IL20, IL22, and IL24 (1, 2). IL10 is secreted by many activated hematopoietic cell types as well as hepatic stellate cells, keratinocytes. IL-10 inhibits the expression of proinflammatory cytokines such as IL-1 and TNFα. Like IL-4, IL-10 enhances humoral immune responses and attenuates cell-mediated immune reactions. Human IL-10 active on murine cells, but murine IL-10 is inactive on human cells. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Measured in a cell proliferation assay using MC/92 mouse mast cells. The ED50 for this effect is typically 2-12 ng/mL. |
Molecular Mass : |
Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 160 amino acid residues. |
AA Sequence : |
SKGHSIKGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNIVLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN |
Endotoxin : |
Less than 1 EU/μg of rRtIL-10 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |