Active Recombinant Rat Il10 Protein (160 aa)
Cat.No. : | Il10-006I |
Product Overview : | Recombinant Rat Il10 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 160 |
Description : | Interleukin-10 also known as cytokine synthesis inhibitory factor (CSIF), is coded by IL10 gene on chromosome 13 in rat. the charter member of the IL 10 family of α helical cytokines that also includes IL19, IL20, IL22, and IL24 (1, 2). IL10 is secreted by many activated hematopoietic cell types as well as hepatic stellate cells, keratinocytes. IL-10 inhibits the expression of proinflammatory cytokines such as IL-1 and TNFα. Like IL-4, IL-10 enhances humoral immune responses and attenuates cell-mediated immune reactions. Human IL-10 active on murine cells, but murine IL-10 is inactive on human cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured in a cell proliferation assay using MC/92 mouse mast cells. The ED50 for this effect is typically 2-12 ng/mL. |
Molecular Mass : | Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 160 amino acid residues. |
AA Sequence : | SKGHSIKGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNIVLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN |
Endotoxin : | Less than 1 EU/μg of rRtIL-10 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il10 interleukin 10 [ Rattus norvegicus ] |
Official Symbol | Il10 |
Synonyms | IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X; |
Gene ID | 25325 |
mRNA Refseq | NM_012854 |
Protein Refseq | NP_036986 |
UniProt ID | P29456 |
◆ Recombinant Proteins | ||
IL10-492D | Recombinant Dog IL10 protein, His-tagged | +Inquiry |
IL10-507H | Active Recombinant Human IL10 | +Inquiry |
IL10-110H | Recombinant Human Interleukin 10 | +Inquiry |
IL10-1555H | Recombinant human IL10, Active | +Inquiry |
IL10-267H | Recombinant Human IL10, StrepII-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
0
Inquiry Basket