Recombinant Rhesus macaque IL10 protein, His-B2M-tagged
| Cat.No. : | IL10-3090R |
| Product Overview : | Recombinant Rhesus macaque IL10 protein(P51496)(19-178aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus macaque |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 19-178aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.7 kDa |
| AA Sequence : | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| IL10-838H | Recombinant Horse IL10 protein, His & GST-tagged | +Inquiry |
| Il10-841R | Recombinant Rat Il10 protein, His & T7-tagged | +Inquiry |
| Il10-18R | Recombinant Rat Il10 protein | +Inquiry |
| IL10-40H | Recombinant Human IL10 Protein | +Inquiry |
| Il10-006I | Active Recombinant Rat Il10 Protein (160 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
