Active Recombinant Rat Il1b Protein (152 aa)
Cat.No. : | Il1b-363I |
Product Overview : | Recombinant rat Interleukin-1 Beta (rat IL-1 Beta) produced in E. coli is a single non-glycosylated polypeptide chain containing 152 amino acids. A fully biologically active molecule, recombinant rat IL-1 Beta protein has a molecular mass of 17.3kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 152 |
Description : | Interleukin-1 Beta (IL-1 Beta) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 10 pg/mL, measured by a cell proliferation assay using mouse D10S cells, corresponding to a specific activity of > 1.0 × 10^8 units/mg. |
Molecular Mass : | 17.3 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant rat Interleukin-1 Beta (IL-1 Beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant rat IL-1 Beta should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Il1b interleukin 1 beta [ Rattus norvegicus ] |
Official Symbol | Il1b |
Synonyms | IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; |
Gene ID | 24494 |
mRNA Refseq | NM_031512 |
Protein Refseq | NP_113700 |
UniProt ID | Q63264 |
◆ Recombinant Proteins | ||
IL1B-364H | Active Recombinant Human IL1B Protein | +Inquiry |
Il1b-101M | Active Recombinant Mouse Il1b Protein | +Inquiry |
IL1B-4503M | Recombinant Mouse IL1B Protein, His (Fc)-Avi-tagged | +Inquiry |
IL1B-2834R | Recombinant Rabbit IL1B protein, His & T7-tagged | +Inquiry |
IL1B-6353H | Recombinant Human IL1B protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il1b Products
Required fields are marked with *
My Review for All Il1b Products
Required fields are marked with *
0
Inquiry Basket