Recombinant Mouse Il1b Protein, His-tagged

Cat.No. : Il1b-7238M
Product Overview : Recombinant mouse IL-1beta, fused to His tag, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 118-269
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.
Form : Liquid
Molecular Mass : 21 kDa
AA Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris pH 8.0, 10 % glycerol
Gene Name Il1b interleukin 1 beta [ Mus musculus (house mouse) ]
Official Symbol Il1b
Synonyms Il1b; interleukin 1 beta; IL-; Il-1b; IL-1beta; interleukin-1 beta; IL-1 beta
Gene ID 16176
mRNA Refseq NM_008361
Protein Refseq NP_032387
UniProt ID P10749

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1b Products

Required fields are marked with *

My Review for All Il1b Products

Required fields are marked with *

0
cart-icon
0
compare icon