Recombinant Mouse Il1b Protein, His-tagged
Cat.No. : | Il1b-7238M |
Product Overview : | Recombinant mouse IL-1beta, fused to His tag, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 118-269 |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response. |
Form : | Liquid |
Molecular Mass : | 21 kDa |
AA Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris pH 8.0, 10 % glycerol |
Gene Name | Il1b interleukin 1 beta [ Mus musculus (house mouse) ] |
Official Symbol | Il1b |
Synonyms | Il1b; interleukin 1 beta; IL-; Il-1b; IL-1beta; interleukin-1 beta; IL-1 beta |
Gene ID | 16176 |
mRNA Refseq | NM_008361 |
Protein Refseq | NP_032387 |
UniProt ID | P10749 |
◆ Recombinant Proteins | ||
IL1B-23H | Active Recombinant Human IL1B | +Inquiry |
IL1B-9908H | Active Recombinant Human IL1B | +Inquiry |
IL1B-744H | Active Recombinant Human IL1B protein(Met1-Ser269), His-tagged | +Inquiry |
IL1B-232B | Recombinant Bovine Interleukin 1, Beta | +Inquiry |
IL1B-577R | Recombinant Rat IL1B, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il1b Products
Required fields are marked with *
My Review for All Il1b Products
Required fields are marked with *