Active Recombinant Human IL1B Protein (153 aa)
Cat.No. : | IL1B-366I |
Product Overview : | Recombinant human Interleukin-1 beta (rhIL-1β) produced in E. coli is a single non-glycosylated polypeptide chain containing 153 amino acids. A fully biologically active molecule, rhIL-1β has a molecular mass of 17.3kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 153 |
Description : | Interleukin-1 beta (rhIL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 1.0 pg/mL, measured by the dose-dependent stimulation of mouse D10S cells, corresponding to a specific activity of 1.0 × 10^9 IU/mg. |
Molecular Mass : | 17.3 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Interleukin-1 beta (rhIL-1β) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-1β should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL1B interleukin 1, beta [ Homo sapiens ] |
Official Symbol | IL1B |
Synonyms | IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA; |
Gene ID | 3553 |
mRNA Refseq | NM_000576 |
Protein Refseq | NP_000567 |
MIM | 147720 |
UniProt ID | P01584 |
◆ Recombinant Proteins | ||
IL1B-250I | Active Recombinant Human IL1B Protein | +Inquiry |
IL1B-6093C | Recombinant Chicken IL1B | +Inquiry |
Il1b-7238M | Recombinant Mouse Il1b Protein, His-tagged | +Inquiry |
IL1B-656C | Active Recombinant Canine IL1B | +Inquiry |
Il1b-509M | Recombinant Mouse Il1b protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
0
Inquiry Basket