| Species : |
Human |
| Source : |
HEK293 |
| Protein Length : |
27-220 aa |
| Description : |
This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. |
| Form : |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80. |
| Bio-activity : |
Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate MCA-PLGL-DPA-AR-NH2 and the IC50 value is < 4 nM. |
| Molecular Mass : |
20 kDa |
| AASequence : |
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
| Endotoxin : |
<1 EU/μg determined by LAL method. |
| Purity : |
Greater than 95% as determined by reducing SDS-PAGE |
| Storage : |
Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage. |
| Shipping : |
Room temperature in continental US; may vary elsewhere. |
| Reconstitution : |
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. |
