Recombinant Human TIMP2 protein

Cat.No. : TIMP2-29289TH
Product Overview : Recombinant Human TIMP2 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 194
Description : This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 3 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2.
Molecular Mass : Approximately 21.8 kDa, a single non-glycosylated polypeptide chain containing 194 amino acids.
AA Sequence : CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Endotoxin : Less than 1 EU/µg of rHuTIMP-2 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TIMP2
Official Symbol TIMP2
Synonyms TIMP2; TIMP metallopeptidase inhibitor 2; tissue inhibitor of metalloproteinase 2; metalloproteinase inhibitor 2; CSC 21K; TIMP-2; tissue inhibitor of metalloproteinases 2; CSC-21K;
Gene ID 7077
mRNA Refseq NM_003255
Protein Refseq NP_003246
MIM 188825
UniProt ID P16035

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIMP2 Products

Required fields are marked with *

My Review for All TIMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon