Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
69 |
Description : |
Human CCL18 is encoded by the CCL18 gene located on the chromosome 17. As also named MIP-4, it shares 61 % sequence identity to human MIP-1α. CCL18 is mainly expressed by lung and some lymphoid tissues like lymph nodes express CCL18 at low level. It is chemotactic for both activated (CD3+) T cells and nonactivated (CD14-) lymphocytes, but not for monocytes or granulocytes. Involved in B-cell migration into B-cell follicles in lymph nodes. CCL18 plays a role in both humoral and cell-mediated immunity responses. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 1.0-10 ng/ml. |
Molecular Mass : |
Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. |
AA Sequence : |
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Endotoxin : |
Less than 1 EU/μg of rHuMIP-4/CCL18 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |