Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
166 |
Description : |
Endothelial-Monocyte Activating Polypeptide II (EMAP-II) is a tumor derived cytokine that exerts a wide range of activities on endothelial cells, monocytes and neutrophils. EMAP-II inhibits endothelial cell proliferation, vasculogenesis, neovessel formation, and can induce apoptosis. It is also chemotactic towards neutrophils and monocytes and induces myeloperoxidase activity from neutrophils. Of clinical importance, EMAP-II inhibits angiogenesis of vascular beds and suppresses the growth of primary and secondary tumors without affecting normal tissues. Mature EMAP-II is an 18.3 kDa protein, which is synthesized as the C-terminal portion of a biologically inactive precursor protein containing a propeptide of 146 amino acid residues. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by the apoptotic effect using serum free human MCF-7 cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg. |
Molecular Mass : |
Approximately 18.2 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids. |
AA Sequence : |
SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK |
Endotoxin : |
Less than 1 EU/μg of rHuEMAP-II as determined by LAL method. |
Purity : |
>98% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |