"INHBB" Related Products

Expand
Expand

Recombinant human Activin B, Active, His-tagged

Cat.No.: INHBB-1546H
Product Overview: Recombinant human Activin B is a polypeptide chain containing 123 amino acids (293- 406 P09529 INHBB_HUMAN) and a His-tag at the N-terminal end. It has a predicted molecular mass of 14 kDa.
Description: Activins are homodimers or heterodimers of the various β subunit isoforms, belonging to the TGF-beta family. Mature Activin B has two chains of 123 amino acids residues (betaB-betaB). Activin exhibits a wide range of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins plays a key role in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Inhibins/Activins are protein that are formed by the dimerization of two subunits, i. e. an α (alpha) with either beta A (βA) - Inhibin A or beta B (βB) - Inhibin B. The subunits betaA and betaB can also form homodimers or heterodimers called Activin: Activin A (betaA -betaA), Activin B (betaB -betaB) and Activin AB (betaA -betaB). The Activin gene family comprises the additional, but poorly characterized members" Activin betaC (βC), beta D (βD) and beta E (βE). As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B.
Source: Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Species: Human
Tag: His
Form: Recombinant human Activin B is lyophilized from Tris HCl 0.05M buffer at pH 7.4.
Molecular Mass: 14 kDa
AA Sequence: HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQ YRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Endotoxin: < 0.04 eu/μg protein (lal>
Purity: >97% by SDS-PAGE gel
Storage: This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Reconstitution: Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Due to the protein nature, dimmers and multimers may be observed. Optimal concentration should be determined for specific application and cell lines.
Gene Name: INHBB inhibin, beta B [ Homo sapiens ]
Official Symbol: INHBB
Synonyms: INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939;
Gene ID: 3625
mRNA Refseq: NM_002193
Protein Refseq: NP_002184
MIM: 147390
UniProt ID: P09529
Chromosome Location: 2cen-q13
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem;
Function: cytokine activity; growth factor activity; hormone activity; host cell surface receptor binding; protein binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.