Recombinant Human INHBB protein, His-tagged
| Cat.No. : | INHBB-6744H |
| Product Overview : | Recombinant Human INHBB protein(P09529)(295-405aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 295-405a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG |
| Gene Name | INHBB inhibin, beta B [ Homo sapiens ] |
| Official Symbol | INHBB |
| Synonyms | INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939; |
| Gene ID | 3625 |
| mRNA Refseq | NM_002193 |
| Protein Refseq | NP_002184 |
| MIM | 147390 |
| UniProt ID | P09529 |
| ◆ Recombinant Proteins | ||
| INHBB-222H | Recombinant Active Human INHBB Protein, His-tagged(C-ter) | +Inquiry |
| INHBB-5890HF | Recombinant Full Length Human INHBB Protein, GST-tagged | +Inquiry |
| INHBB-2885H | Recombinant Human Activin B | +Inquiry |
| INHBB-5119H | Active Recombinant Human INHBB Protein | +Inquiry |
| INHBB-4548M | Recombinant Mouse INHBB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INHBB-2612HCL | Recombinant Human INHBB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBB Products
Required fields are marked with *
My Review for All INHBB Products
Required fields are marked with *
