Recombinant Human INHBB, Animal Free

• Cat.No.: INHBB-138H
• Product Overview: Recombinant human Activin B is a 14 KDa betaB single chain, containing 123 amino residues. Human recombinant protein expressed in Nicotiana benthamiana. Recombinant human Activin B contains a 10-His-tag at the N-terminal end, is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. Animal free product.

Specification

• Species: Human
• Source: Nicotiana Benthamiana
• Tag: Non
• Protein Length: 123 a.a.
• Description: Activins are homodimers or heterodimers of the various beta subunit isoforms, belonging to the TGF-beta family. Mature Activin B has two chains of 123 amino acids residues (betaB-betaB). Activin exhibits a wide range of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins plays a key role in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Inhibins/Activins are protein that are formed by the dimerization of two subunits, i. e. an α (alpha) with either beta A (betaA) - Inhibin A or beta B (betaB) - Inhibin B. The subunits betaA and betaB can also form homodimers or heterodimers called Activin: Activin A (betaA -betaA), Activin B (betaB -betaB) and Activin AB (betaA -betaB). The Activin gene family comprises the additional, but poorly characterized members" Activin betaC (betaC), beta D (betaD) and beta E (betaE). As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B.
• Form: Lyophilized from Tris HCl 0.05M buffer at pH 7.4.
• Molecular Mass: Recombinant human Activin B is a 14 KDa betaB single chain, containing 123 amino residues.
• AA Sequence: HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQ YRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG
• Endotoxin: < 0.04="" eu="" ug="" protein="" (lal="">
• Purity: >97% by SDS-PAGE gel
• Applications: Western blot, Immunogen
• Storage: This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C and it is recommended to add a carrier protein (0.1% HSA or BSA). Repeated freezing and thawing is not recommended.
• Reconstitution: Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Due to the protein nature, dimmers and multimers may be observed. Upon reconstitution, It can be stored in working aliquots at –20°C for future use. Optimal reconstitution please follow batch Quality Control sheet instructions.

Gene Information

• Gene Name: INHBB inhibin, beta B [ Homo sapiens ]
• Official Symbol: INHBB
• Synonyms: INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939
• Gene ID: 3625
• mRNA Refseq: NM_002193
• Protein Refseq: NP_002184
• MIM: 147390
• UniProt ID: P09529
• Chromosome Location: 2cen-q13
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem
• Function: cytokine activity; growth factor activity; hormone activity; host cell surface receptor binding; protein binding; protein homodimerization activity