"TGFB2" Related Products

Expand

Recombinant human TGFB2, Active

Cat.No.: TGFB2-1566H
Product Overview: Recombinant human TGF-β2 is a 27.08 kDa protein composed of two identical 118 amino acid polypeptide chains linked by a single disulphide bond.
Description: Recombinant human TGF-β2 is a 27.08 kDa protein composed of two identical 118 amino acid peptide chains linked by a single disulphide bond. Transforming growth factor–β is a family of five related cytokines that have been shown on a wide variety of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-β (TGF-β1, TGF-β2 and TGF-β3) signal through the same receptor and elicit similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.
Source: Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Species: Human
Form: Recombinant human TGF-b2 is lyophilized from a Tris HCl 0.05M buffer at pH 7.4.
Molecular Mass: 27.08 kDa
AA Sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Endotoxin: < 0.04 eu/μg protein (lal>
Purity: >97% by SDS-PAGE gel
Storage: This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Reconstitution: Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 25ng/ul. At higher concentration the solubility may be reduced and multimers generated.
Gene Name: TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
Official Symbol: TGFB2
Synonyms: TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892;
Gene ID: 7042
mRNA Refseq: NM_001135599
Protein Refseq: NP_001129071
MIM: 190220
UniProt ID: P61812
Chromosome Location: 1q41
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem;
Function: beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.