Recombinant human TGFB2, Active
Cat.No. : | TGFB2-1566H |
Product Overview : | Recombinant human TGF-β2 is a 27.08 kDa protein composed of two identical 118 amino acid polypeptide chains linked by a single disulphide bond. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | Non |
Description : | Recombinant human TGF-β2 is a 27.08 kDa protein composed of two identical 118 amino acid peptide chains linked by a single disulphide bond. Transforming growth factor–β is a family of five related cytokines that have been shown on a wide variety of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-β (TGF-β1, TGF-β2 and TGF-β3) signal through the same receptor and elicit similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing. |
Form : | Recombinant human TGF-b2 is lyophilized from a Tris HCl 0.05M buffer at pH 7.4. |
Molecular Mass : | 27.08 kDa |
AA Sequence : | HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : | Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 25ng/ul. At higher concentration the solubility may be reduced and multimers generated. |
Gene Name | TGFB2 transforming growth factor, beta 2 [ Homo sapiens ] |
Official Symbol | TGFB2 |
Synonyms | TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892; |
Gene ID | 7042 |
mRNA Refseq | NM_001135599 |
Protein Refseq | NP_001129071 |
MIM | 190220 |
UniProt ID | P61812 |
Chromosome Location | 1q41 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; |
Function | beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase |
◆ Recombinant Proteins | ||
TGFB2-348H | Recombinant Human Transforming Growth Factor, Beta 2 | +Inquiry |
TGFB2-104H | Active Recombinant Human TGFB2 Protein | +Inquiry |
TGFB2-2196H | Recombinant Human TGFB2 protein, His-tagged | +Inquiry |
TGFB2-16704M | Recombinant Mouse TGFB2 protein, His-tagged | +Inquiry |
TGFB2-2893H | Recombinant Human TGFB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB2-1119HCL | Recombinant Human TGFB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFB2 Products
Required fields are marked with *
My Review for All TGFB2 Products
Required fields are marked with *
0
Inquiry Basket