"IGF1" Related Products

Expand
Expand

Recombinant Human IGF1 therapeutic protein

Cat.No. : IGF1-P059H
Product Overview : IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human?IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human?IGF-1.
Description : IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1.
Source : E. coli
Species : Human
Molecular Mass : 76.5 Kda
Protein length : 70 Aa
AA Sequence : GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Unit Definition : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ]
Official Symbol : IGF1
Synonyms : IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I;
Gene ID : 3479
mRNA Refseq : NM_000618
Protein Refseq : NP_000609
MIM : 147440
UniProt ID : P05019
Chromosome Location : 12q23.2
Pathway : Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dilated cardiomyopathy, organism-specific biosystem;
Function : growth factor activity; hormone activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; integrin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.