Recombinant Bovine Igf1 Protein
Cat.No. : | Igf1-01B |
Product Overview : | IGF-1 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Description : | Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is is a primary mediator of the effects of growth hormone (GH). Growth hormone stimulates the liver to produce IGF-1. IGF-1 then stimulates systemic body growth, and has growth-promoting effects on almost every cell in the body, especially skeletal muscle, cartilage, bone, liver, kidney, nerves, skin, hematopoietic cell, and lungs. IGF-1 is highly homologous across species. |
Molecular Mass : | 7.6 kDa |
AA Sequence : | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA(70) |
Applications : | The IGF-1 endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control. |
References : | 1. Growth of rumen papillae in weaned calves is associated with lower expression of insulin-like growth factor-binding proteins 2, 3, and 6. Nishihara K, Suzuki Y, Kim D, Roh S. Anim Sci J. 2019 Sep;90(9):1287-1292. doi: 10.1111/asj.13270. Epub 2019 Jul 10. |
Gene Name | IGF1 insulin like growth factor 1 [ Bos taurus (cattle) ] |
Official Symbol | IGF1 |
Synonyms | IGF1; insulin like growth factor 1; IGF-1; IGF-I; insulin-like growth factor I; class 1 insulin-like growth factor I preproprotein; insulin growth factor-1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor I (somatomedin C); prepro-IGF-I; somatomedin |
Gene ID | 281239 |
mRNA Refseq | NM_001077828 |
Protein Refseq | NP_001071296 |
UniProt ID | P07455 |
◆ Recombinant Proteins | ||
IGF1-2215R | Recombinant Rhesus monkey IGF1 Protein, His-tagged | +Inquiry |
Igf1-814R | Recombinant Rat Igf1 protein, His & GST-tagged | +Inquiry |
IGF1-3928H | Recombinant Human IGF1 protein, 15N Stable Isotope Labeled | +Inquiry |
IGF1-652H | Active Recombinant Human Insulin Like Growth Factor-I,HIgG1 Fc-tagged | +Inquiry |
IGF1-085I | Active Recombinant Human LR3IGF1 Protein (83 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Igf1 Products
Required fields are marked with *
My Review for All Igf1 Products
Required fields are marked with *